Tesamorelin 2mg

Tesamorelin consists of the 44 amino acid sequence of human growth hormone releasing factor (GRF), with a 3-hexenoyl group attached to its tyrosine N-terminal residue.

Synonyms: Egrifta, TH9507

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL

IUPAC Condensed: Unk-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

Molecular Weight:  5136g/mol

CAS Number: 218949-48-5

PubChem CID: 16137828

Further references

PubChem

Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c.

Source: Biosynthesis

Reconstitution: Reconstitute with Bacteriostatic Water

Usage: Product is prepared for LABORATORY RESEARCH ONLY. Tesamorelin for sale at Pure Peptides UK is limited to scientific research and education only – Only buy Tesamorelin if you are a licenced researcher.