The Versatile LL-37 Peptide: A Defender with Multiple Functions
Introduction:
In the constantly evolving world of biotechnology, researchers have identified a promising peptide called LL-37. This peptide has garnered attention due to its multifaceted roles within our immune system. In this blog post, we will explore the world of LL-37 without making medical claims and examine its potential applications.
Understanding LL-37:
LL-37 is a naturally occurring antimicrobial peptide found in humans. Comprising 37 amino acids, it is mainly produced by immune cells like neutrophils and certain skin cells. While it was initially recognized for its antimicrobial properties, recent research has unveiled a wider range of functions.
The Role of LL-37 in Immune Defense:
LL-37 is known for its antimicrobial abilities. It can target various microorganisms, including bacteria, viruses, and fungi, by disrupting their membranes.
LL-37 also has a role in regulating immune responses. It can help modulate the body’s immune response, ensuring a balanced and effective defence mechanism.
LL-37 has been linked to promoting wound healing by aiding in cell migration and tissue regeneration.
Emerging Applications of LL-37:
LL-37 shows promise in potential treatments for various infectious diseases, including those resistant to antibiotics.
Researchers are exploring LL-37’s potential in managing inflammatory disorders, although further research is needed.
Recent studies suggest that LL-37 may play a role in cancer immunotherapy, although more research is required to understand its full potential.
Conclusion:
LL-37 is a fascinating peptide with various roles in the immune system. Its antimicrobial properties, immunomodulatory effects, and involvement in wound healing make it a versatile component. As researchers continue to explore LL-37’s potential, we can anticipate its application in various fields beyond the scope of this article. Keep an eye out for further developments involving LL-37!
Technical details
Synonyms: Cathelicidin, antibacterial protein LL-37, GTPL5527
Sequence: [LL-37, 37 aa]
IUPAC Condensed: HH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Molecular Weight: 4493.342g/mol
CAS Number: 154947-66-7
PubChem CID: 134611881
Further references
Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c.
Source: Biosynthesis
Reconstitution: Reconstitute with Bacteriostatic Water
Usage: Product is prepared for LABORATORY RESEARCH ONLY. KPV for sale at Pure Peptides UK is limited to scientific research and education only – Only buy KPV if you are a licenced researcher.
* Images for illustration purposes only
There are no reviews yet.